PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa005553
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family GRF
Protein Properties Length: 324aa    MW: 36764.8 Da    PI: 8.8893
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
gnl|UG|Lsa#S58686304PU_refUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC78.94.8e-2582125144
        WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                d+epgrCrRtDGKkWRCs+++++++k+CErH+hrgr+rsrk++e
  Lsa005553  82 DPEPGRCRRTDGKKWRCSKEAYPDSKYCERHMHRGRNRSRKPVE 125
                79***************************************998 PP

2QLQ591.4e-201247237
        QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqaiqk 37
               +FT +Q+q+L++Q+l+yKy+++++P+Pp+Ll+ iq+
  Lsa005553 12 PFTSSQWQELEHQALVYKYMISGMPIPPDLLFSIQR 47
               8*********************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.4E-131147IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166622.7671247IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.7E-151246IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.32582126IPR014977WRC domain
PfamPF088792.9E-2183125IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 324 aa     Download sequence    Send to blast
MTTARNDNSR FPFTSSQWQE LEHQALVYKY MISGMPIPPD LLFSIQRSLD SSTRLLLHHH  60
SPHHSIGVGW NCFQMGFGRK IDPEPGRCRR TDGKKWRCSK EAYPDSKYCE RHMHRGRNRS  120
RKPVEVNSAP NTPPALSIST KPMMNYPVSP FLYPQIQLSS SSSSRAPVNG NVVSSHQDRF  180
WLESSSGYSS RSEKDNSYGM KEEMAEHPFL SERCGSGTMS ASMGGDSWNL EPLAMNNNNT  240
SSSSSSSSSL MVHTKQRAYY DYDQLTLKIN QRKDEQPKKV MHHFFDESPQ NDDVDGGNKD  300
SSTTQLSISI PNGARDFFQT HNHK
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006342364.15e-90PREDICTED: growth-regulating factor 1
TrEMBLA0A103YN991e-130A0A103YN99_CYNCS; Glutamine-Leucine-Glutamine, QLQ
STRINGVIT_11s0016g01250.t011e-85(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13960.12e-52growth-regulating factor 5